Q9BTY7 has 390 amino acids
Query: DUF384 [M=55] Accession: PF04064.17 Description: Domain of unknown function (DUF384) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-25 73.2 0.0 1.2e-24 72.3 0.0 1.5 1 Q9BTY7 Domain annotation for each sequence (and alignments): >> Q9BTY7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.3 0.0 1.2e-24 1.2e-24 1 54 [. 292 345 .. 292 346 .. 0.98 Alignments for each domain: == domain 1 score: 72.3 bits; conditional E-value: 1.2e-24 DUF384 1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeee 54 +++lL++t gR+ +R++g+Y ilRelH +e +++vr ace+l+q+Li+dE+e Q9BTY7 292 AIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPER 345 79**************************************************96 PP
Or compare Q9BTY7 to CDD or PaperBLAST