PaperBLAST – Find papers about a protein or its homologs

 

Align Q9BTY7 to PF04064 (DUF384)

Q9BTY7 has 390 amino acids

Query:       DUF384  [M=55]
Accession:   PF04064.17
Description: Domain of unknown function (DUF384)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.2e-25   73.2   0.0    1.2e-24   72.3   0.0    1.5  1  Q9BTY7    


Domain annotation for each sequence (and alignments):
>> Q9BTY7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   72.3   0.0   1.2e-24   1.2e-24       1      54 [.     292     345 ..     292     346 .. 0.98

  Alignments for each domain:
  == domain 1  score: 72.3 bits;  conditional E-value: 1.2e-24
  DUF384   1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeee 54 
             +++lL++t  gR+ +R++g+Y ilRelH +e +++vr ace+l+q+Li+dE+e 
  Q9BTY7 292 AIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPER 345
             79**************************************************96 PP



Or compare Q9BTY7 to CDD or PaperBLAST