PaperBLAST – Find papers about a protein or its homologs

 

Align Q9D6I0 to PF16297 (DUF4939)

Q9D6I0 has 112 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.4e-67  209.6   0.8    3.8e-67  209.5   0.8    1.0  1  Q9D6I0    


Domain annotation for each sequence (and alignments):
>> Q9D6I0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  209.5   0.8   3.8e-67   3.8e-67       1     112 []       2     112 .]       2     112 .] 0.98

  Alignments for each domain:
  == domain 1  score: 209.5 bits;  conditional E-value: 3.8e-67
  DUF4939   1 drrkklrivlmerarlrkrrwrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkee 102
              drr+kl+++lm++++lrk+rw+npipfpelfdGe+e+lpefivqtlsymlvdektf++d++kv+flitrlkGral+w+m+y+q+dsp+lnny++flnemkee
   Q9D6I0   2 DRRIKLIMALMAWPELRKGRWQNPIPFPELFDGEMEKLPEFIVQTLSYMLVDEKTFDTDKRKVMFLITRLKGRALQWAMRYLQTDSPMLNNYSGFLNEMKEE 103
              789*************************************************************************************************** PP

  DUF4939 103 fGwedddedf 112
              fGwe +dedf
   Q9D6I0 104 FGWE-EDEDF 112
              ****.88886 PP



Or compare Q9D6I0 to CDD or PaperBLAST