Q9HC07 has 324 amino acids
Query: GDT1 [M=75] Accession: PF01169.24 Description: Divalent cation/proton antiporter GDT1 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-50 154.9 19.3 7.4e-30 89.5 3.7 2.2 2 Q9HC07 Domain annotation for each sequence (and alignments): >> Q9HC07 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.4 7.7 3.3e-24 3.3e-24 2 75 .] 99 171 .. 98 171 .. 0.97 2 ! 89.5 3.7 7.4e-30 7.4e-30 1 75 [] 238 312 .. 238 312 .. 0.98 Alignments for each domain: == domain 1 score: 71.4 bits; conditional E-value: 3.3e-24 GDT1 2 tsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaallFlvfG 75 +++++i+++ElGDkT+++++++A+ry+ l+V++Ga+lAl l+t l+vl+G + + +p+ ++ +v+ +lF++fG Q9HC07 99 AAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYAT-TVIPRVYTYYVSTVLFAIFG 171 7899**********************************************888.89*****************9 PP == domain 2 score: 89.5 bits; conditional E-value: 7.4e-30 GDT1 1 ltsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaallFlvfG 75 +++++l+flaE+GD++ql+ti+LAar++p++V +G t++++l+t+lav++G+++a++++ r+v+++++++Fl+f+ Q9HC07 238 VQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFA 312 5899*********************************************************************97 PP
Or compare Q9HC07 to CDD or PaperBLAST