PaperBLAST – Find papers about a protein or its homologs

 

Align Q9I793 to PF06649 (DUF1161)

Q9I793 has 75 amino acids

Query:       DUF1161  [M=52]
Accession:   PF06649.16
Description: Protein of unknown function (DUF1161)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.1e-30   92.2   2.3    1.3e-30   91.9   2.3    1.1  1  Q9I793    


Domain annotation for each sequence (and alignments):
>> Q9I793  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.9   2.3   1.3e-30   1.3e-30       1      52 []      25      74 ..      25      74 .. 1.00

  Alignments for each domain:
  == domain 1  score: 91.9 bits;  conditional E-value: 1.3e-30
  DUF1161  1 CeelkaeIdaKiqanGVtsytLeiVdkdeaakasgkVVGsCengtkkIvYqR 52
             CeelkaeIdaKi+anGV  ytLeiVdk+++  +++kVVG+C++gtk+IvYqR
   Q9I793 25 CEELKAEIDAKIKANGVPAYTLEIVDKGSV--TDKKVVGTCDGGTKEIVYQR 74
             ******************************..9******************9 PP



Or compare Q9I793 to CDD or PaperBLAST