PaperBLAST – Find papers about a protein or its homologs

 

Align Q9JKL4 to PF04430 (DUF498)

Q9JKL4 has 185 amino acids

Query:       DUF498  [M=109]
Accession:   PF04430.18
Description: Protein of unknown function (DUF498/DUF598)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.6e-40  122.7   0.0    7.8e-40  121.6   0.0    1.5  2  Q9JKL4    


Domain annotation for each sequence (and alignments):
>> Q9JKL4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.0      0.22      0.22      28      46 ..      24      43 ..      18      51 .. 0.67
   2 !  121.6   0.0   7.8e-40   7.8e-40       1     109 []      61     169 ..      61     169 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.22
  DUF498 28 fawev.akaedlteeslall 46
            + w++ +++++l++++ +l+
  Q9JKL4 24 RLWRNpRRGHRLSPADDELY 43
            67876345999999887776 PP

  == domain 2  score: 121.6 bits;  conditional E-value: 7.8e-40
  DUF498   1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyNvlasegrr 103
             id+y+++gf++ g+++ g++++lp++v +w+v +++d+tees++l+ +lep++e++++GtG+++ +l+p++++a+++rgi+vev+dt++Ac+t+N+l +egr 
  Q9JKL4  61 IDSYSSRGFTICGNRVFGPCVLLPQTVVQWNVGSHQDITEESFSLFWMLEPRIEIVVVGTGNKTERLHPQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRV 163
             89****************************9877********************************************************************* PP

  DUF498 104 vaaaLi 109
              +aaLi
  Q9JKL4 164 TGAALI 169
             ****98 PP



Or compare Q9JKL4 to CDD or PaperBLAST