Q9JKL4 has 185 amino acids
Query: DUF498 [M=109] Accession: PF04430.18 Description: Protein of unknown function (DUF498/DUF598) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-40 122.7 0.0 7.8e-40 121.6 0.0 1.5 2 Q9JKL4 Domain annotation for each sequence (and alignments): >> Q9JKL4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.22 0.22 28 46 .. 24 43 .. 18 51 .. 0.67 2 ! 121.6 0.0 7.8e-40 7.8e-40 1 109 [] 61 169 .. 61 169 .. 0.98 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.22 DUF498 28 fawev.akaedlteeslall 46 + w++ +++++l++++ +l+ Q9JKL4 24 RLWRNpRRGHRLSPADDELY 43 67876345999999887776 PP == domain 2 score: 121.6 bits; conditional E-value: 7.8e-40 DUF498 1 idgygeggfrvngkkyegsllvlpgevfawevakaedlteeslallellepkpevlilGtGarlrflppelrealkergigvevmdtraAcrtyNvlasegrr 103 id+y+++gf++ g+++ g++++lp++v +w+v +++d+tees++l+ +lep++e++++GtG+++ +l+p++++a+++rgi+vev+dt++Ac+t+N+l +egr Q9JKL4 61 IDSYSSRGFTICGNRVFGPCVLLPQTVVQWNVGSHQDITEESFSLFWMLEPRIEIVVVGTGNKTERLHPQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRV 163 89****************************9877********************************************************************* PP DUF498 104 vaaaLi 109 +aaLi Q9JKL4 164 TGAALI 169 ****98 PP
Or compare Q9JKL4 to CDD or PaperBLAST