PaperBLAST – Find papers about a protein or its homologs

 

Align Q9P2E3 to PF20173 (ZnF_RZ-type)

Q9P2E3 has 1918 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.1e-26   76.2   2.7    6.1e-26   76.2   2.7    4.5  5  Q9P2E3    


Domain annotation for each sequence (and alignments):
>> Q9P2E3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.4   1.7      0.21      0.21      21      37 ..    1437    1452 ..    1436    1459 .. 0.79
   2 ?  -11.5   9.5         1         1      23      40 ..    1481    1489 ..    1477    1505 .. 0.47
   3 ?   -5.5   7.7         1         1      16      38 ..    1546    1566 ..    1544    1568 .. 0.83
   4 ?   -3.8   0.2      0.58      0.58      33      41 ..    1618    1626 ..    1614    1626 .. 0.85
   5 !   76.2   2.7   6.1e-26   6.1e-26       8      53 ..    1843    1888 ..    1834    1889 .. 0.93

  Alignments for each domain:
  == domain 1  score: -2.4 bits;  conditional E-value: 0.21
  ZnF_RZ-type   21 vigeCGrameesrCpeC 37  
                   +i +CG++   ++C  C
       Q9P2E3 1437 TILDCGHPCP-GSCHSC 1452
                   5889**9985.567777 PP

  == domain 2  score: -11.5 bits;  conditional E-value: 1
  ZnF_RZ-type   23 geCGrameesrCpeCgat 40  
                   ge         Cp C++t
       Q9P2E3 1481 GE---------CPPCQRT 1489
                   44.........4444332 PP

  == domain 3  score: -5.5 bits;  conditional E-value: 1
  ZnF_RZ-type   16 nGHpYvigeCGrameesrCpeCg 38  
                   +GHp+ ig CG++   ++C  C+
       Q9P2E3 1546 CGHPC-IGLCGEPCP-KKCRICH 1566
                   89998.8******96.5798887 PP

  == domain 4  score: -3.8 bits;  conditional E-value: 0.58
  ZnF_RZ-type   33 rCpeCgatI 41  
                    Cp C+ +I
       Q9P2E3 1618 VCPICQVPI 1626
                   7****9987 PP

  == domain 5  score: 76.2 bits;  conditional E-value: 6.1e-26
  ZnF_RZ-type    8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                   +ghw+kC+nGH+Yvig+CG+ame+++Cp+C++ IGG++h+l+++n+
       Q9P2E3 1843 RGHWFKCRNGHIYVIGDCGGAMERGTCPDCKEVIGGTNHTLERSNQ 1888
                   89****************************************9997 PP



Or compare Q9P2E3 to CDD or PaperBLAST