Q9P2E3 has 1918 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.2 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-26 76.2 2.7 6.1e-26 76.2 2.7 4.5 5 Q9P2E3 Domain annotation for each sequence (and alignments): >> Q9P2E3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 1.7 0.21 0.21 21 37 .. 1437 1452 .. 1436 1459 .. 0.79 2 ? -11.5 9.5 1 1 23 40 .. 1481 1489 .. 1477 1505 .. 0.47 3 ? -5.5 7.7 1 1 16 38 .. 1546 1566 .. 1544 1568 .. 0.83 4 ? -3.8 0.2 0.58 0.58 33 41 .. 1618 1626 .. 1614 1626 .. 0.85 5 ! 76.2 2.7 6.1e-26 6.1e-26 8 53 .. 1843 1888 .. 1834 1889 .. 0.93 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.21 ZnF_RZ-type 21 vigeCGrameesrCpeC 37 +i +CG++ ++C C Q9P2E3 1437 TILDCGHPCP-GSCHSC 1452 5889**9985.567777 PP == domain 2 score: -11.5 bits; conditional E-value: 1 ZnF_RZ-type 23 geCGrameesrCpeCgat 40 ge Cp C++t Q9P2E3 1481 GE---------CPPCQRT 1489 44.........4444332 PP == domain 3 score: -5.5 bits; conditional E-value: 1 ZnF_RZ-type 16 nGHpYvigeCGrameesrCpeCg 38 +GHp+ ig CG++ ++C C+ Q9P2E3 1546 CGHPC-IGLCGEPCP-KKCRICH 1566 89998.8******96.5798887 PP == domain 4 score: -3.8 bits; conditional E-value: 0.58 ZnF_RZ-type 33 rCpeCgatI 41 Cp C+ +I Q9P2E3 1618 VCPICQVPI 1626 7****9987 PP == domain 5 score: 76.2 bits; conditional E-value: 6.1e-26 ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53 +ghw+kC+nGH+Yvig+CG+ame+++Cp+C++ IGG++h+l+++n+ Q9P2E3 1843 RGHWFKCRNGHIYVIGDCGGAMERGTCPDCKEVIGGTNHTLERSNQ 1888 89****************************************9997 PP
Or compare Q9P2E3 to CDD or PaperBLAST