Q9UIL1 has 159 amino acids
Query: DUF2205 [M=75] Accession: PF10224.14 Description: Short coiled-coil protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-31 92.4 3.3 1e-30 92.0 3.3 1.2 1 Q9UIL1 Domain annotation for each sequence (and alignments): >> Q9UIL1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.0 3.3 1e-30 1e-30 10 74 .. 89 153 .. 79 154 .. 0.92 Alignments for each domain: == domain 1 score: 92.0 bits; conditional E-value: 1e-30 DUF2205 10 leklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitssts 74 +++e e++++L++q+ eLq++L++l++rvdaVkee++KL+sen++L++YI++Lms+s+++++t+ Q9UIL1 89 ENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTD 153 578999*********************************************************97 PP
Or compare Q9UIL1 to CDD or PaperBLAST