Q9ZGH7 has 426 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-51 158.0 0.3 1.3e-50 157.4 0.3 1.3 1 Q9ZGH7 Domain annotation for each sequence (and alignments): >> Q9ZGH7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 157.4 0.3 1.3e-50 1.3e-50 3 145 .] 271 413 .. 269 413 .. 0.98 Alignments for each domain: == domain 1 score: 157.4 bits; conditional E-value: 1.3e-50 THHHHHTSSSEEEE---TTTTSS-SS--SSEEE--S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--T CS EryCIII-like_C 3 lldelgevDaeivvtldararedlaslPdnvRlvdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpk 97 +l++l+++D e+v+tlda +r ++++ P+ R dfvP+++lLp+c+ai+hhGGaG+++ta++ vPq++l++ +D +v+a++vae GaG lp+ Q9ZGH7 271 ILEALADLDIELVATLDASQRAEIRNYPKHTRFTDFVPMHALLPSCSAIIHHGGAGTYATAVINAVPQVMLAELWDAPVKARAVAEQGAGFFLPP 365 799******************************************************************************************** PP TT--HHHHHHHHHHHHH-HHHHHHHHHHHHHHHTS--HHHHHHHHHHH CS EryCIII-like_C 98 deldadslaeavarvledpayreaaaklaeealaePkPtevvkklvel 145 el+++ ++ av r+l+dp+ aa +l+ee+ +P+P+ +v++l+ l Q9ZGH7 366 AELTPQAVRDAVVRILDDPSVATAAHRLREETFGDPTPAGIVPELERL 413 ********************************************9875 PP
Or compare Q9ZGH7 to CDD or PaperBLAST