PaperBLAST – Find papers about a protein or its homologs

 

Align R7TWK6 to PF06840 (PDC10_C)

R7TWK6 has 208 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.2e-42  128.8   0.7    5.8e-42  128.0   0.7    1.4  1  R7TWK6    


Domain annotation for each sequence (and alignments):
>> R7TWK6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  128.0   0.7   5.8e-42   5.8e-42       1      90 []      68     157 ..      68     157 .. 0.99

  Alignments for each domain:
  == domain 1  score: 128.0 bits;  conditional E-value: 5.8e-42
  PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
              v+++eslLrl+g ++++e++++r ee+f  ln++a++LkkiLsriPdei+dRkkfLetikeiAsai++lLdavn+++++i ++++k+ale
   R7TWK6  68 VDMTESLLRLEGINNSTEFQVTRPEEQFRYLNERAMSLKKILSRIPDEIYDRKKFLETIKEIASAIRQLLDAVNSIFSFIDDPSHKQALE 157
              89**************************************************************************************98 PP



Or compare R7TWK6 to CDD or PaperBLAST