REBASE::Lsp6406VI has 1204 amino acids
Query: DUF559 [M=109] Accession: PF04480.16 Description: Protein of unknown function (DUF559) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-39 120.4 0.7 3.3e-39 119.4 0.7 1.5 1 REBASE::Lsp6406VI Domain annotation for each sequence (and alignments): >> REBASE::Lsp6406VI # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 119.4 0.7 3.3e-39 3.3e-39 4 108 .. 696 800 .. 693 801 .. 0.97 Alignments for each domain: == domain 1 score: 119.4 bits; conditional E-value: 3.3e-39 DUF559 4 kanarklRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlk 95 +ar+lR+ qt ae+ LW+ lr+rrl glkfrRq+ ig++i+Df+c +a l+ve+DG h+++ e+D+ R+e++ + Gf++lRfkn+ +l REBASE::Lsp6406VI 696 LLKARELRKIQTPAEEILWQCLRSRRLGGLKFRRQHNIGQFIADFYCHEACLVVEVDGEVHNTQVERDQDRDEWMIANGFRILRFKNEAILD 787 568***************************************************************************************** PP DUF559 96 nieevleeilkal 108 + e+vl++il ++ REBASE::Lsp6406VI 788 DLETVLATILVTV 800 *********9876 PP
Or compare REBASE::Lsp6406VI to CDD or PaperBLAST