REBASE::M.Bau1420I has 490 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-15 43.2 0.0 3.2e-15 42.5 0.0 1.3 1 REBASE::M.Bau1420I Domain annotation for each sequence (and alignments): >> REBASE::M.Bau1420I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.5 0.0 3.2e-15 3.2e-15 20 149 .. 175 298 .. 170 354 .. 0.80 Alignments for each domain: == domain 1 score: 42.5 bits; conditional E-value: 3.2e-15 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsq 109 +v+++ ++++ + DP CG+ ++l+ a + ++ p + ++ ++++ ++ + g D+d+ +++ + N g+++ i +++ REBASE::M.Bau1420I 175 MVKMSAPRPDDEICDPACGTAGFLVSASEQLRESHPEVF-------TNKEQRHFFHNSMFHGYDFDSTMLRIGSMNMMLHGIEQPdIRYRD 258 9**********************************9888.......3333333447777***********************9855***** PP UPF0020 110 adaakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149 ++ ++ +++ +i++npP+ +l+ + + ++L + + REBASE::M.Bau1420I 259 SLSENFSAEVEKYTLILANPPFAGSLDYEATSQDLQRVVK 298 *******88889***************9999999987643 PP
Or compare REBASE::M.Bau1420I to CDD or PaperBLAST