REBASE::M.Bpe137II has 731 amino acids
Query: DUF1156 [M=73] Accession: PF06634.16 Description: Protein of unknown function (DUF1156) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-12 31.7 2.0 6.6e-12 31.7 2.0 2.1 2 REBASE::M.Bpe137II Domain annotation for each sequence (and alignments): >> REBASE::M.Bpe137II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.7 2.0 6.6e-12 6.6e-12 14 46 .. 51 82 .. 43 95 .. 0.83 2 ? -2.7 0.1 0.37 0.37 32 49 .. 473 490 .. 472 498 .. 0.77 Alignments for each domain: == domain 1 score: 31.7 bits; conditional E-value: 6.6e-12 DUF1156 14 EksirhgqhlstLhlwWaRrPLaavRAvilaqL 46 E+ + g+++ t+h+wWaRrP a+RA ++a+L REBASE::M.Bpe137II 51 ER-YGRGETPHTIHVWWARRPHSAMRALVYAAL 82 44.45588***********************98 PP == domain 2 score: -2.7 bits; conditional E-value: 0.37 DUF1156 32 RrPLaavRAvilaqLvpa 49 RrP + RA a p+ REBASE::M.Bpe137II 473 RRPVQVQRASAAALPYPD 490 9*******9877765555 PP
Or compare REBASE::M.Bpe137II to CDD or PaperBLAST