REBASE::M.MfoCT6I has 506 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.0 0.0 1.1e-13 37.4 0.0 1.3 1 REBASE::M.MfoCT6I Domain annotation for each sequence (and alignments): >> REBASE::M.MfoCT6I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.0 1.1e-13 1.1e-13 20 149 .. 191 314 .. 185 367 .. 0.83 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.1e-13 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqa 110 +v+++ k+++ + DP CG+ ++l+ a +++ + l + a+++ ++ + g D+d+ +++ + N g++ i +++ REBASE::M.MfoCT6I 191 MVKMTAPKPTDEICDPACGTAGFLVAASEYVRSTHE-------SVLTDAAQRKHFHNSMFHGYDFDSTMLRIGSMNMLMHGIESPdIRYRDS 275 9************************77777766662.......2244445555558888***********************9854999999 PP UPF0020 111 daakLrlkegevdvivtnpPYGerlgskkalekLYsefl 149 ++ +++ +i++npP+ +l+ + + ++L + + REBASE::M.MfoCT6I 276 LSEGASEDAEKYTLILANPPFAGSLDYESTSKDLQRVVK 314 9999999999****************9999999987654 PP
Or compare REBASE::M.MfoCT6I to CDD or PaperBLAST