REBASE::M.PfrJS11I has 534 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-15 42.9 0.0 4.1e-15 42.1 0.0 1.4 1 REBASE::M.PfrJS11I Domain annotation for each sequence (and alignments): >> REBASE::M.PfrJS11I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.1 0.0 4.1e-15 4.1e-15 20 148 .. 219 341 .. 213 396 .. 0.82 Alignments for each domain: == domain 1 score: 42.1 bits; conditional E-value: 4.1e-15 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefs 108 +v + ++++++ DP CG+ ++lI a +++ p +l + + + +++ + + g+D+d+ +++ a N g+++ +++++ REBASE::M.PfrJS11I 219 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRDHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYR 301 999999*********************999999998665........44455555444469**********************87357788 PP UPF0020 109 qadaakLrlkegevdvivtnpPYGerlgskkalekLYsef 148 + +eg++ ++++npP+ +l+ + + ++L + + REBASE::M.PfrJS11I 302 DSLSEGAADDEGSYSLVLANPPFAGSLDYESTSKDLQQVV 341 877777778999****************999999997754 PP
Or compare REBASE::M.PfrJS11I to CDD or PaperBLAST