REBASE::M.SspCFMR7I has 506 amino acids
Query: UPF0020 [M=197] Accession: PF01170.24 Description: RMKL-like, methyltransferase domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-14 37.7 0.0 1.8e-13 36.8 0.0 1.5 1 REBASE::M.SspCFMR7I Domain annotation for each sequence (and alignments): >> REBASE::M.SspCFMR7I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.8 0.0 1.8e-13 1.8e-13 20 146 .. 171 291 .. 166 348 .. 0.79 Alignments for each domain: == domain 1 score: 36.8 bits; conditional E-value: 1.8e-13 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeear.aelklygsDldrrvvqgareNaekagvgdl.ief 107 +v++++ + + + DP CG+ ++l+ aa ++++ r+ +e++++ +e + g+D+d+ +++ + N g+++ i + REBASE::M.SspCFMR7I 171 MVEMTQPGPRDEICDPACGTAGFLVQAAAYVQRVH----RDAL----LGVEQRKHfNESMFHGFDFDPTMLRIGSMNMLLHGIENPdIRY 252 9*******************************999....4444....4555556657788***********************9854999 PP UPF0020 108 sqadaakLrlkegevdvivtnpPYGerlgskkalekLYs 146 ++ + ++ + + +i++npP+ +l+ + + +L + REBASE::M.SspCFMR7I 253 RDSLGENAAAEAERYSLILANPPFAGSLDYESTAVDLQR 291 99888888867779*************998887777655 PP
Or compare REBASE::M.SspCFMR7I to CDD or PaperBLAST