S8GSS4 has 1231 amino acids
Query: DUF202 [M=68]
Accession: PF02656.19
Description: Domain of unknown function (DUF202)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.2e-16 44.8 0.1 1.8e-15 43.5 0.1 1.8 1 S8GSS4
Domain annotation for each sequence (and alignments):
>> S8GSS4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 43.5 0.1 1.8e-15 1.8e-15 2 65 .. 1117 1177 .. 1116 1180 .. 0.90
Alignments for each domain:
== domain 1 score: 43.5 bits; conditional E-value: 1.8e-15
DUF202 2 dglAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrr 65
++AnERTfL++l+ +++l++l+++ll++ gg + + ++g++l++ +++l+++++ + r
S8GSS4 1117 SFFANERTFLQYLQKAVYLGSLAITLLQW---GGGGVVPDVAGFCLAFGVLALLVYSYRVFEER 1177
68**************************9...55566689******************999877 PP
Or compare S8GSS4 to CDD or PaperBLAST