SwissProt::A0A078H868 has 387 amino acids
Query: DUF2838 [M=111]
Accession: PF10998.12
Description: Protein of unknown function (DUF2838)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-42 130.0 8.2 2.3e-42 130.0 8.2 2.4 3 SwissProt::A0A078H868
Domain annotation for each sequence (and alignments):
>> SwissProt::A0A078H868
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 130.0 8.2 2.3e-42 2.3e-42 2 111 .] 71 180 .. 70 180 .. 0.99
2 ? -2.1 0.8 0.25 0.25 35 54 .. 227 246 .. 218 251 .. 0.56
3 ? -1.8 0.2 0.19 0.19 78 92 .. 298 312 .. 289 330 .. 0.49
Alignments for each domain:
== domain 1 score: 130.0 bits; conditional E-value: 2.3e-42
DUF2838 2 klsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGp 89
k+++++gvl + +++llg++p+ +plvy++ +++++plr+++yr kk+hY+llD+CY++n+++l+ ll++p++++lf+++f++a+Gp
SwissProt::A0A078H868 71 KVTHLVGVLGFGGFCFLLGARPQDIPLVYCFFYVIFVPLRWIYYRFKKWHYYLLDFCYYANTIFLVDLLLYPKNEKLFMVCFSFAEGP 158
99************************************************************************************** PP
DUF2838 90 lalAiitwrnslvfhsldkvtS 111
la+A+i+wr+slvf s+dk++S
SwissProt::A0A078H868 159 LAWALIVWRCSLVFSSVDKIVS 180
********************97 PP
== domain 2 score: -2.1 bits; conditional E-value: 0.25
DUF2838 35 lvllplryvtyrkkklhYfl 54
++l+ + +v+y+ ++ Yfl
SwissProt::A0A078H868 227 TWLFLIPLVVYTLWQVLYFL 246
33344444555555555555 PP
== domain 3 score: -1.8 bits; conditional E-value: 0.19
DUF2838 78 lfkavfvlanGplal 92
lf+a+f++a+ l +
SwissProt::A0A078H868 298 LFQAIFTVATMALTV 312
333333333322222 PP
Or compare SwissProt::A0A078H868 to CDD or PaperBLAST