SwissProt::A0A0R4I9Y1 has 5061 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.3 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-20 58.3 1.8 2.3e-20 58.3 1.8 2.4 3 SwissProt::A0A0R4I9Y1 Domain annotation for each sequence (and alignments): >> SwissProt::A0A0R4I9Y1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.23 0.23 36 47 .. 255 266 .. 254 271 .. 0.80 2 ? -2.6 0.1 0.24 0.24 30 41 .. 3989 4000 .. 3984 4009 .. 0.80 3 ! 58.3 1.8 2.3e-20 2.3e-20 8 53 .. 4445 4490 .. 4437 4491 .. 0.91 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.23 ZnF_RZ-type 36 eCgatIGGeshn 47 eC++++G+++ n SwissProt::A0A0R4I9Y1 255 ECEEKVGDNQKN 266 9******98766 PP == domain 2 score: -2.6 bits; conditional E-value: 0.24 ZnF_RZ-type 30 eesrCpeCgatI 41 e + Cp C+++ SwissProt::A0A0R4I9Y1 3989 EAQHCPVCREPL 4000 6789****9986 PP == domain 3 score: 58.3 bits; conditional E-value: 2.3e-20 ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53 + ++Y C n H +++geCGr+m +s+C +Cg +IGGe+h+++ g+t SwissProt::A0A0R4I9Y1 4445 KLKMYFCSNSHACFVGECGRPMAKSKCATCGVEIGGEGHIPVPGFT 4490 7799*************************************99986 PP
Or compare SwissProt::A0A0R4I9Y1 to CDD or PaperBLAST