PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A0A0R4I9Y1 to PF20173 (ZnF_RZ-type)

SwissProt::A0A0R4I9Y1 has 5061 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.3
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    2.3e-20   58.3   1.8    2.3e-20   58.3   1.8    2.4  3  SwissProt::A0A0R4I9Y1  


Domain annotation for each sequence (and alignments):
>> SwissProt::A0A0R4I9Y1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.5   0.1      0.23      0.23      36      47 ..     255     266 ..     254     271 .. 0.80
   2 ?   -2.6   0.1      0.24      0.24      30      41 ..    3989    4000 ..    3984    4009 .. 0.80
   3 !   58.3   1.8   2.3e-20   2.3e-20       8      53 ..    4445    4490 ..    4437    4491 .. 0.91

  Alignments for each domain:
  == domain 1  score: -2.5 bits;  conditional E-value: 0.23
            ZnF_RZ-type  36 eCgatIGGeshn 47 
                            eC++++G+++ n
  SwissProt::A0A0R4I9Y1 255 ECEEKVGDNQKN 266
                            9******98766 PP

  == domain 2  score: -2.6 bits;  conditional E-value: 0.24
            ZnF_RZ-type   30 eesrCpeCgatI 41  
                             e + Cp C+++ 
  SwissProt::A0A0R4I9Y1 3989 EAQHCPVCREPL 4000
                             6789****9986 PP

  == domain 3  score: 58.3 bits;  conditional E-value: 2.3e-20
            ZnF_RZ-type    8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                             + ++Y C n H +++geCGr+m +s+C +Cg +IGGe+h+++ g+t
  SwissProt::A0A0R4I9Y1 4445 KLKMYFCSNSHACFVGECGRPMAKSKCATCGVEIGGEGHIPVPGFT 4490
                             7799*************************************99986 PP



Or compare SwissProt::A0A0R4I9Y1 to CDD or PaperBLAST