SwissProt::A0A0R4IBK5 has 5209 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.2 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-27 79.1 6.5 1.8e-26 77.9 2.8 3.1 3 SwissProt::A0A0R4IBK5 Domain annotation for each sequence (and alignments): >> SwissProt::A0A0R4IBK5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.1 0.14 0.14 34 51 .. 18 35 .. 15 37 .. 0.83 2 ? 0.4 0.0 0.028 0.028 6 22 .. 2118 2134 .. 2115 2135 .. 0.87 3 ! 77.9 2.8 1.8e-26 1.8e-26 2 53 .. 4495 4546 .. 4494 4547 .. 0.95 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.14 ZnF_RZ-type 34 CpeCgatIGGeshnlaag 51 C eCg + +s++ ++g SwissProt::A0A0R4IBK5 18 CSECGHKLQSQSYETTQG 35 999999998888888776 PP == domain 2 score: 0.4 bits; conditional E-value: 0.028 ZnF_RZ-type 6 kgtghwYkCpnGHpYvi 22 ++g ++k n H Yvi SwissProt::A0A0R4IBK5 2118 DSKGNMWKSSNKHLYVI 2134 56899***********9 PP == domain 3 score: 77.9 bits; conditional E-value: 1.8e-26 ZnF_RZ-type 2 akafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53 a++++g+ +wY CpnGHp+++geCG++me+srCp+C a+IGG++h+++ g++ SwissProt::A0A0R4IBK5 4495 AQQAMGHLQWYFCPNGHPCTVGECGQPMEVSRCPDCDAEIGGSNHRPVDGFR 4546 6889999*****************************************9986 PP
Or compare SwissProt::A0A0R4IBK5 to CDD or PaperBLAST