PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A0A0R4IBK5 to PF20173 (ZnF_RZ-type)

SwissProt::A0A0R4IBK5 has 5209 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    7.5e-27   79.1   6.5    1.8e-26   77.9   2.8    3.1  3  SwissProt::A0A0R4IBK5  


Domain annotation for each sequence (and alignments):
>> SwissProt::A0A0R4IBK5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.1      0.14      0.14      34      51 ..      18      35 ..      15      37 .. 0.83
   2 ?    0.4   0.0     0.028     0.028       6      22 ..    2118    2134 ..    2115    2135 .. 0.87
   3 !   77.9   2.8   1.8e-26   1.8e-26       2      53 ..    4495    4546 ..    4494    4547 .. 0.95

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.14
            ZnF_RZ-type 34 CpeCgatIGGeshnlaag 51
                           C eCg +   +s++ ++g
  SwissProt::A0A0R4IBK5 18 CSECGHKLQSQSYETTQG 35
                           999999998888888776 PP

  == domain 2  score: 0.4 bits;  conditional E-value: 0.028
            ZnF_RZ-type    6 kgtghwYkCpnGHpYvi 22  
                              ++g ++k  n H Yvi
  SwissProt::A0A0R4IBK5 2118 DSKGNMWKSSNKHLYVI 2134
                             56899***********9 PP

  == domain 3  score: 77.9 bits;  conditional E-value: 1.8e-26
            ZnF_RZ-type    2 akafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                             a++++g+ +wY CpnGHp+++geCG++me+srCp+C a+IGG++h+++ g++
  SwissProt::A0A0R4IBK5 4495 AQQAMGHLQWYFCPNGHPCTVGECGQPMEVSRCPDCDAEIGGSNHRPVDGFR 4546
                             6889999*****************************************9986 PP



Or compare SwissProt::A0A0R4IBK5 to CDD or PaperBLAST