SwissProt::A0A178VBJ0 has 640 amino acids
Query: DUF630 [M=59] Accession: PF04783.16 Description: Protein of unknown function (DUF630) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-26 77.8 4.7 1.8e-24 72.0 3.4 2.8 2 SwissProt::A0A178VBJ0 Domain annotation for each sequence (and alignments): >> SwissProt::A0A178VBJ0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.0 3.4 1.8e-24 1.8e-24 1 59 [] 1 59 [. 1 59 [. 0.98 2 ! 4.1 0.0 0.003 0.003 26 46 .. 434 454 .. 431 466 .. 0.84 Alignments for each domain: == domain 1 score: 72.0 bits; conditional E-value: 1.8e-24 DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59 MGc++S++d++e v++C++Rkr+lk++v+aR++L+ +H+ Yl+SLr+vg++L +F +e SwissProt::A0A178VBJ0 1 MGCCQSRIDSKEIVSRCKARKRYLKHLVKARQTLSVSHALYLRSLRAVGSSLVHFSSKE 59 *******************************************************9876 PP == domain 2 score: 4.1 bits; conditional E-value: 0.003 DUF630 26 qaveaRyaLAaaHvaYlqSLr 46 q ++ ++L +a+ +Y+qSL SwissProt::A0A178VBJ0 434 QWHHSFCNLVKAQRDYIQSLT 454 55677799************7 PP
Or compare SwissProt::A0A178VBJ0 to CDD or PaperBLAST