SwissProt::A0QU81 has 181 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-17 47.7 0.0 3.2e-15 42.6 0.0 2.2 2 SwissProt::A0QU81 Domain annotation for each sequence (and alignments): >> SwissProt::A0QU81 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.6 0.0 3.2e-15 3.2e-15 11 78 .. 29 96 .. 28 97 .. 0.95 2 ! 2.9 0.0 0.0082 0.0082 1 17 [. 121 137 .. 121 141 .. 0.90 Alignments for each domain: == domain 1 score: 42.6 bits; conditional E-value: 3.2e-15 CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 l++ a+R++ a+ +a+ K ++g ++ dp+Re++v++ ++ +a+++++dp +v ++fr+ i+++ +++ SwissProt::A0QU81 29 LVDAAAQRLQTADPVAASKFRSGGAIDDPDREQQVIAAVTGDATRHNIDPGYVHDVFRNQIDATSSVE 96 78999********************************************************9987665 PP == domain 2 score: 2.9 bits; conditional E-value: 0.0082 CM_2 1 RkeIdeiDrelleLlae 17 R++Id ++r +++ +a+ SwissProt::A0QU81 121 RQKIDTLNRTMVDEIAR 137 99**********98775 PP
Or compare SwissProt::A0QU81 to CDD or PaperBLAST