SwissProt::A1L3C1 has 212 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.9e-21 60.2 0.2 1.4e-20 59.6 0.2 1.2 1 SwissProt::A1L3C1
Domain annotation for each sequence (and alignments):
>> SwissProt::A1L3C1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.6 0.2 1.4e-20 1.4e-20 4 66 .. 96 158 .. 93 160 .. 0.93
Alignments for each domain:
== domain 1 score: 59.6 bits; conditional E-value: 1.4e-20
GARIL_Rab2_bd 4 ltrllPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplst 66
l l+Pl+fv+l v+d++ q+lk+k+ tgR+fyl+L +++++++ f +w+rl++ Lr + +t
SwissProt::A1L3C1 96 LLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPT 158
55689**************************************************99988766 PP
Or compare SwissProt::A1L3C1 to CDD or PaperBLAST