PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A7KAK6 to PF06722 (EryCIII-like_C)

SwissProt::A7KAK6 has 1241 amino acids

Query:       EryCIII-like_C  [M=145]
Accession:   PF06722.18
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      1e-19   57.1   0.0    2.3e-19   56.0   0.0    1.5  1  SwissProt::A7KAK6  


Domain annotation for each sequence (and alignments):
>> SwissProt::A7KAK6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.0   0.0   2.3e-19   2.3e-19      28     125 ..    1087    1182 ..    1056    1198 .. 0.89

  Alignments for each domain:
  == domain 1  score: 56.0 bits;  conditional E-value: 2.3e-19
                         S--SSEEE--S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT--HHHHHHHHHHHHH-HH CS
     EryCIII-like_C   28 slPdnvRlvdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkdeldadslaeavarvledpa 117 
                          lP+++  ++ vP   l p+ +a vhhGG+G+t ++l +GvP i+ p + D+   a rv +lG+G++l+  +l+ +sla a+++v+ +  
  SwissProt::A7KAK6 1087 VLPPEIYNAGSVPHDWLFPQIDAAVHHGGSGTTGASLRFGVPTIIKPFFGDQKFYAGRVEDLGCGVSLK--DLNYKSLARALKEVTTNTR 1174
                         58*****************************************************************97..578889*********9998 PP

                         HHHHHHHH CS
     EryCIII-like_C  118 yreaaakl 125 
                           e+a+ +
  SwissProt::A7KAK6 1175 IIEKAKLV 1182
                         88877654 PP



Or compare SwissProt::A7KAK6 to CDD or PaperBLAST