SwissProt::A7KAK6 has 1241 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-19 54.7 0.0 1.2e-18 53.6 0.0 1.6 1 SwissProt::A7KAK6
Domain annotation for each sequence (and alignments):
>> SwissProt::A7KAK6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 53.6 0.0 1.2e-18 1.2e-18 29 123 .. 1088 1180 .. 1055 1195 .. 0.87
Alignments for each domain:
== domain 1 score: 53.6 bits; conditional E-value: 1.2e-18
EryCIII-like_C 29 lpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpay 118
lp+++ ++ vP + l p+ +a vHhgG+g+t ++l fGvP ++ p + d++ a rv +lG+g++l+ +l+ +s+a+a++ev+ +
SwissProt::A7KAK6 1088 LPPEIYNAGSVPHDWLFPQIDAAVHHGGSGTTGASLRFGVPTIIKPFFGDQKFYAGRVEDLGCGVSLK--DLNYKSLARALKEVTTNTRI 1175
7999999**********************************************************997..577889********999887 PP
EryCIII-like_C 119 raaaa 123
+ a+
SwissProt::A7KAK6 1176 IEKAK 1180
77765 PP
Or compare SwissProt::A7KAK6 to CDD or PaperBLAST