SwissProt::A7KAK6 has 1241 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-19 57.1 0.0 2.3e-19 56.0 0.0 1.5 1 SwissProt::A7KAK6 Domain annotation for each sequence (and alignments): >> SwissProt::A7KAK6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.0 0.0 2.3e-19 2.3e-19 28 125 .. 1087 1182 .. 1056 1198 .. 0.89 Alignments for each domain: == domain 1 score: 56.0 bits; conditional E-value: 2.3e-19 S--SSEEE--S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT--HHHHHHHHHHHHH-HH CS EryCIII-like_C 28 slPdnvRlvdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkdeldadslaeavarvledpa 117 lP+++ ++ vP l p+ +a vhhGG+G+t ++l +GvP i+ p + D+ a rv +lG+G++l+ +l+ +sla a+++v+ + SwissProt::A7KAK6 1087 VLPPEIYNAGSVPHDWLFPQIDAAVHHGGSGTTGASLRFGVPTIIKPFFGDQKFYAGRVEDLGCGVSLK--DLNYKSLARALKEVTTNTR 1174 58*****************************************************************97..578889*********9998 PP HHHHHHHH CS EryCIII-like_C 118 yreaaakl 125 e+a+ + SwissProt::A7KAK6 1175 IIEKAKLV 1182 88877654 PP
Or compare SwissProt::A7KAK6 to CDD or PaperBLAST