PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A9ULB4 to PF05254 (UPF0203)

SwissProt::A9ULB4 has 78 amino acids

Query:       UPF0203  [M=69]
Accession:   PF05254.16
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      4e-30   90.2   0.6    4.6e-30   90.0   0.6    1.1  1  SwissProt::A9ULB4  


Domain annotation for each sequence (and alignments):
>> SwissProt::A9ULB4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   90.0   0.6   4.6e-30   4.6e-30       1      57 [.       2      58 ..       2      67 .. 0.95

  Alignments for each domain:
  == domain 1  score: 90.0 bits;  conditional E-value: 4.6e-30
            UPF0203  1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgie 57
                       +s+++eCt++K++Yd+CFn+W++ekflkg+ + ++C++lf++Y++Cvqka+k+k+i 
  SwissProt::A9ULB4  2 NSVGEECTDMKREYDQCFNRWFAEKFLKGECSGDPCTELFRRYRDCVQKAIKDKDIP 58
                       69****************************************************997 PP



Or compare SwissProt::A9ULB4 to CDD or PaperBLAST