SwissProt::B0XYF7 has 331 amino acids
Query: DUF1746 [M=116] Accession: PF08508.14 Description: Fungal domain of unknown function (DUF1746) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-48 148.1 2.7 9.8e-48 147.6 2.7 1.2 1 SwissProt::B0XYF7 Domain annotation for each sequence (and alignments): >> SwissProt::B0XYF7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 147.6 2.7 9.8e-48 9.8e-48 1 116 [] 60 173 .. 60 173 .. 0.97 Alignments for each domain: == domain 1 score: 147.6 bits; conditional E-value: 9.8e-48 DUF1746 1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesftellpaekpllvaillsnllclllhllfslpsageatrgylhggliidFiG 92 +Ld+l+y++l++lYymDcs++++++Raivql+f+tpk+++f ++++p+++ai++sn++c+++h +f+ p+a+eatrgylhggl+idFiG SwissProt::B0XYF7 60 DLDILIYCELSALYYMDCSVILFAIRAIVQLIFFTPKAPPFDP--TRNQPFIGAIFVSNIFCMIFHNFFTHPEASEATRGYLHGGLLIDFIG 149 69*************************************8755..489******************************************** PP DUF1746 93 qkaptsrlellllDllilllqllm 116 qkap+ ++l+llD+l+l+l+l+m SwissProt::B0XYF7 150 QKAPIPLFRLFLLDFLVLILDLVM 173 ***********************9 PP
Or compare SwissProt::B0XYF7 to CDD or PaperBLAST