SwissProt::B7Z0X7 has 61 amino acids
Query: DUF4516 [M=46] Accession: PF14990.11 Description: Domain of unknown function (DUF4516) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-29 87.7 0.1 1.8e-29 87.5 0.1 1.1 1 SwissProt::B7Z0X7 Domain annotation for each sequence (and alignments): >> SwissProt::B7Z0X7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.5 0.1 1.8e-29 1.8e-29 1 46 [] 1 46 [. 1 46 [. 0.98 Alignments for each domain: == domain 1 score: 87.5 bits; conditional E-value: 1.8e-29 DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46 mPaGvswgqYlk+++++++SM+aG+q+VH+yYKP++++++++++e+ SwissProt::B7Z0X7 1 MPAGVSWGQYLKFLGCALASMMAGSQAVHLYYKPLEDLRVYIEQEQ 46 9******************************************985 PP
Or compare SwissProt::B7Z0X7 to CDD or PaperBLAST