SwissProt::B7Z0X7 has 61 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-29 87.7 0.1 1.8e-29 87.5 0.1 1.1 1 SwissProt::B7Z0X7
Domain annotation for each sequence (and alignments):
>> SwissProt::B7Z0X7
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.5 0.1 1.8e-29 1.8e-29 1 46 [] 1 46 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 87.5 bits; conditional E-value: 1.8e-29
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46
mPaGvswgqYlk+++++++SM+aG+q+VH+yYKP++++++++++e+
SwissProt::B7Z0X7 1 MPAGVSWGQYLKFLGCALASMMAGSQAVHLYYKPLEDLRVYIEQEQ 46
9******************************************985 PP
Or compare SwissProt::B7Z0X7 to CDD or PaperBLAST