SwissProt::B9RK42 has 391 amino acids
Query: DUF2838 [M=111] Accession: PF10998.12 Description: Protein of unknown function (DUF2838) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-42 131.0 7.7 1.1e-42 131.0 7.7 2.1 2 SwissProt::B9RK42 Domain annotation for each sequence (and alignments): >> SwissProt::B9RK42 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.0 7.7 1.1e-42 1.1e-42 2 111 .] 70 179 .. 69 179 .. 0.99 2 ? -1.4 0.1 0.15 0.15 51 61 .. 235 245 .. 222 272 .. 0.69 Alignments for each domain: == domain 1 score: 131.0 bits; conditional E-value: 1.1e-42 DUF2838 2 klsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalA 93 k++++lgvl + +++llg++p+ +p+vy++ +++++plr+++yr kk+hYfllD+CY++n+++l+ ll++p++++lf+++f++a+Gpla+A SwissProt::B9RK42 70 KVTHLLGVLGFGGFCFLLGARPQDIPYVYCLFFFIFVPLRWIYYRFKKWHYFLLDFCYYANTIFLVDLLLYPKDEKLFMVCFSFAEGPLAWA 161 99****************************************************************************************** PP DUF2838 94 iitwrnslvfhsldkvtS 111 +i+wr+slvf s+dk++S SwissProt::B9RK42 162 LIVWRCSLVFSSVDKIVS 179 ****************97 PP == domain 2 score: -1.4 bits; conditional E-value: 0.15 DUF2838 51 hYfllDlCYfv 61 Yfl l Yf+ SwissProt::B9RK42 235 AYFLWQLLYFL 245 45555555554 PP
Or compare SwissProt::B9RK42 to CDD or PaperBLAST