PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::C0HLM6 to PF15061 (DUF4538)

SwissProt::C0HLM6 has 69 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.4e-31   92.7   0.0      5e-31   92.6   0.0    1.0  1  SwissProt::C0HLM6  


Domain annotation for each sequence (and alignments):
>> SwissProt::C0HLM6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.6   0.0     5e-31     5e-31       1      57 []       4      60 ..       4      60 .. 0.98

  Alignments for each domain:
  == domain 1  score: 92.6 bits;  conditional E-value: 5e-31
            DUF4538  1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
                       +r+l++al++gGf++++g+A+YPI+++P+l+ eeY+k+Q++nragi qe++qP+g+k
  SwissProt::C0HLM6  4 ARNLRTALIFGGFISMVGAAFYPIYFRPLLRLEEYQKEQAVNRAGIVQEDVQPPGLK 60
                       69*****************************************************97 PP



Or compare SwissProt::C0HLM6 to CDD or PaperBLAST