SwissProt::C0HLM6 has 69 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-31 92.7 0.0 5e-31 92.6 0.0 1.0 1 SwissProt::C0HLM6
Domain annotation for each sequence (and alignments):
>> SwissProt::C0HLM6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.6 0.0 5e-31 5e-31 1 57 [] 4 60 .. 4 60 .. 0.98
Alignments for each domain:
== domain 1 score: 92.6 bits; conditional E-value: 5e-31
DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
+r+l++al++gGf++++g+A+YPI+++P+l+ eeY+k+Q++nragi qe++qP+g+k
SwissProt::C0HLM6 4 ARNLRTALIFGGFISMVGAAFYPIYFRPLLRLEEYQKEQAVNRAGIVQEDVQPPGLK 60
69*****************************************************97 PP
Or compare SwissProt::C0HLM6 to CDD or PaperBLAST