SwissProt::C4B4E5 has 1475 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-13 36.7 0.0 4.1e-13 35.6 0.0 1.5 1 SwissProt::C4B4E5
Domain annotation for each sequence (and alignments):
>> SwissProt::C4B4E5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 35.6 0.0 4.1e-13 4.1e-13 28 98 .. 1282 1352 .. 1271 1377 .. 0.91
Alignments for each domain:
== domain 1 score: 35.6 bits; conditional E-value: 4.1e-13
EryCIII-like_C 28 elpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskd 98
+p+++ ++ P + l + +a HhgG+g+t ++l +G+P ++ p + d++ + rv ++G gi+l+k
SwissProt::C4B4E5 1282 VMPPEIHVIKSAPHDWLFSQIDAAAHHGGSGTTGASLRAGIPTIIRPFFGDQFFFGSRVEDIGVGICLKKW 1352
5799999999*********************************************************9975 PP
Or compare SwissProt::C4B4E5 to CDD or PaperBLAST