SwissProt::D3Z1D3 has 1412 amino acids
Query: DUF4585 [M=73]
Accession: PF15232.10
Description: Domain of unknown function (DUF4585)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-31 92.6 4.7 1.9e-30 91.1 4.7 1.9 1 SwissProt::D3Z1D3
Domain annotation for each sequence (and alignments):
>> SwissProt::D3Z1D3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.1 4.7 1.9e-30 1.9e-30 1 73 [] 1251 1322 .. 1251 1322 .. 0.97
Alignments for each domain:
== domain 1 score: 91.1 bits; conditional E-value: 1.9e-30
DUF4585 1 saaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgayp 73
+++atq k+L+Dp+sG+y+v+d+Plqvk+kt++DpetG+YV+v++ps+e+ +se+ ++l++p+ l+Pg++p
SwissProt::D3Z1D3 1251 PYPATQ-KVLQDPQSGQYFVFDVPLQVKIKTFYDPETGKYVKVSVPSSEEASSEPPLQDALAAPYLLYPGFRP 1322
689999.************************************************99*************986 PP
Or compare SwissProt::D3Z1D3 to CDD or PaperBLAST