SwissProt::E1B9I5 has 170 amino acids
Query: DUF3695 [M=101]
Accession: PF12494.12
Description: Protein of unknown function (DUF3695)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-46 140.3 0.2 1.1e-45 139.9 0.2 1.2 1 SwissProt::E1B9I5
Domain annotation for each sequence (and alignments):
>> SwissProt::E1B9I5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 139.9 0.2 1.1e-45 1.1e-45 2 100 .. 30 127 .. 29 128 .. 0.97
Alignments for each domain:
== domain 1 score: 139.9 bits; conditional E-value: 1.1e-45
DUF3695 2 pfknptklaqqlepweRLfstqtlsSvrreayffdpkiPkDsLDfrLaarYdhhteafkekneillqqeTiqdtsgrvlknfptevlsppke 93
p+knpt+laqq+epw RL+st+t++S++r+ +ff ++iPkD+LDfrLaa+Y+hht++fk+k+eil++qeTiqdt++ ++++fp+e+l+ p++
SwissProt::E1B9I5 30 PYKNPTHLAQQQEPWCRLSSTPTITSMKRDGFFFYSEIPKDDLDFRLAALYNHHTGTFKNKSEILTHQETIQDTRR-IKTQFPGEFLPAPQP 120
79**********************************************************************9987.*************** PP
DUF3695 94 dpltspl 100
+ts++
SwissProt::E1B9I5 121 PLITSRA 127
9998876 PP
Or compare SwissProt::E1B9I5 to CDD or PaperBLAST