SwissProt::E9PYL2 has 2035 amino acids
Query: DUF4211 [M=137]
Accession: PF13926.10
Description: Domain of unknown function (DUF4211)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-16 46.3 0.0 5.4e-16 45.2 0.0 1.6 1 SwissProt::E9PYL2
Domain annotation for each sequence (and alignments):
>> SwissProt::E9PYL2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.2 0.0 5.4e-16 5.4e-16 22 136 .. 1838 1943 .. 1817 1944 .. 0.82
Alignments for each domain:
== domain 1 score: 45.2 bits; conditional E-value: 5.4e-16
DUF4211 22 srkskkklkehFkdvvewlvhnaidpdflkslekkddelylvalkklddevkgladsllsssaWkpeFkkalearPelevteleaeeksC 111
+ +++ ++e ++++ve+lv+ a+dpd+ ++le+ +delyl++++k+d ++ ++++ l++ ++p +al+++P+l+v+++ +
SwissProt::E9PYL2 1838 RLLKTRAMREMYRSYVEMLVSTALDPDMIQALEDTHDELYLPPMRKIDGLLNEHKKKVLKRLSLSPALQDALHTFPQLQVEQTGEGSP-- 1925
4567899*************************************************************************99766555.. PP
DUF4211 112 dACnrskhpatfevrlsGkpYnket 136
+ +++r +G+pYn++t
SwissProt::E9PYL2 1926 -------EEGAVRLRPAGEPYNRKT 1943
.......223344445566666666 PP
Or compare SwissProt::E9PYL2 to CDD or PaperBLAST