SwissProt::I1S8Q3 has 1443 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.2e-13 34.8 0.0 2.3e-12 33.2 0.0 1.9 1 SwissProt::I1S8Q3
Domain annotation for each sequence (and alignments):
>> SwissProt::I1S8Q3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 33.2 0.0 2.3e-12 2.3e-12 28 100 .. 1254 1326 .. 1245 1356 .. 0.89
Alignments for each domain:
== domain 1 score: 33.2 bits; conditional E-value: 2.3e-12
EryCIII-like_C 28 elpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdel 100
+p ++ ++ P + l + +a HhgG+g+t ++l +G+P ++ p + d++ + rv +lG g++++k ++
SwissProt::I1S8Q3 1254 VIPAEIHVITSAPHDWLFSQIDAAAHHGGSGTTGASLRAGIPTIIRPFFGDQFFFSTRVEDLGVGVCVRKWGT 1326
578999999999******************************************************9988655 PP
Or compare SwissProt::I1S8Q3 to CDD or PaperBLAST