SwissProt::L0R6Q1 has 103 amino acids
Query: DUF4535 [M=45]
Accession: PF15054.10
Description: Domain of unknown function (DUF4535)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-13 37.1 0.1 2.1e-13 36.1 0.1 1.6 1 SwissProt::L0R6Q1
Domain annotation for each sequence (and alignments):
>> SwissProt::L0R6Q1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 36.1 0.1 2.1e-13 2.1e-13 3 33 .. 66 96 .. 64 100 .. 0.88
Alignments for each domain:
== domain 1 score: 36.1 bits; conditional E-value: 2.1e-13
DUF4535 3 fsFglGtycGiYvAQNYeVPnvkklantgle 33
+ F +Gt +GiY AQ Y VPnv+k+ ++ l+
SwissProt::L0R6Q1 66 LGFAVGTCTGIYAAQAYAVPNVEKTLRDYLQ 96
569*********************9988876 PP
Or compare SwissProt::L0R6Q1 to CDD or PaperBLAST