SwissProt::M0RD54 has 1422 amino acids
Query: DUF4585 [M=73]
Accession: PF15232.10
Description: Domain of unknown function (DUF4585)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-31 92.5 6.3 2.4e-30 90.8 6.3 2.0 1 SwissProt::M0RD54
Domain annotation for each sequence (and alignments):
>> SwissProt::M0RD54
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.8 6.3 2.4e-30 2.4e-30 1 73 [] 1260 1331 .. 1260 1331 .. 0.97
Alignments for each domain:
== domain 1 score: 90.8 bits; conditional E-value: 2.4e-30
DUF4585 1 saaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgayp 73
+++atq k+L+Dp+sG+y+v+d+Plqvk+kt++DpetG+YV+v++ps+e+++se+ ++l++p+ l+Pg+ p
SwissProt::M0RD54 1260 PYPATQ-KVLQDPQSGQYFVFDMPLQVKIKTFYDPETGKYVKVSVPSSEEDPSEPPLQDALTAPYLLYPGFQP 1331
689999.***************************************************************976 PP
Or compare SwissProt::M0RD54 to CDD or PaperBLAST