SwissProt::O31460 has 91 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-17 49.6 1.8 1.2e-17 49.6 1.8 1.8 2 SwissProt::O31460
Domain annotation for each sequence (and alignments):
>> SwissProt::O31460
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.6 1.8 1.2e-17 1.2e-17 3 49 .] 14 60 .. 12 60 .. 0.96
2 ? -1.0 0.1 0.081 0.081 46 47 .. 78 79 .. 63 90 .. 0.58
Alignments for each domain:
== domain 1 score: 49.6 bits; conditional E-value: 1.2e-17
DUF1648 3 illplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
++++++l++++yp+LP q+P+H++++ pD +++Kl g ++lP+l++
SwissProt::O31460 14 VIAAFILSIVFYPFLPTQMPIHYDVANSPDLTVNKLAGTVMLPVLMV 60
789******************************************96 PP
== domain 2 score: -1.0 bits; conditional E-value: 0.081
DUF1648 46 ll 47
+l
SwissProt::O31460 78 IL 79
22 PP
Or compare SwissProt::O31460 to CDD or PaperBLAST