SwissProt::O34968 has 331 amino acids
Query: DUF3048 [M=148] Accession: PF11258.12 Description: Protein of unknown function (DUF3048) N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-58 181.4 0.0 1e-57 180.6 0.0 1.4 1 SwissProt::O34968 Domain annotation for each sequence (and alignments): >> SwissProt::O34968 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 180.6 0.0 1e-57 1e-57 1 148 [] 37 179 .. 37 179 .. 0.96 Alignments for each domain: == domain 1 score: 180.6 bits; conditional E-value: 1e-57 DUF3048 1 lTGepavdeelakqrPvaVmieNskaarpqsGlskAdvvyEalvEggiTRlmavfesekepekiGpvRSaRpyyielakefdailvhaGgse 92 lTG+ ++++++ ++rPvaV+++N+++arpqsGlskAd+v Eal+Eg+iTR++a+f+s + pe++GpvRSaR+y++ l+++fd+i+vh+G+s+ SwissProt::O34968 37 LTGL-KTEQKVTERRPVAVVVNNHPKARPQSGLSKADIVIEALAEGQITRFLAIFQS-QMPETVGPVRSAREYFVTLSNGFDSIFVHHGWSP 126 8***.6**************************************************7.********************************** PP DUF3048 93 ealellkkkakidnldgleaekaeaafyRdkdrkaphnlytsgeklakaaekkgys 148 a+++l++ d ++gl+ ++++f+R + k phn yts++ ++kaae+kgy+ SwissProt::O34968 127 GAKKQLESG-AADYMNGLD--FDGSLFWRADFSKPPHNSYTSYDYIKKAAEQKGYK 179 ********7.56*****76..5568****************************995 PP
Or compare SwissProt::O34968 to CDD or PaperBLAST