SwissProt::O74375 has 164 amino acids
Query: Cg6151-P [M=113] Accession: PF10233.13 Description: Uncharacterized conserved protein CG6151-P Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-40 123.6 15.5 3e-40 123.3 15.5 1.1 1 SwissProt::O74375 Domain annotation for each sequence (and alignments): >> SwissProt::O74375 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 123.3 15.5 3e-40 3e-40 1 113 [] 30 141 .. 30 141 .. 0.99 Alignments for each domain: == domain 1 score: 123.3 bits; conditional E-value: 3e-40 Cg6151-P 1 lGilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatsli 92 lGilsi+lci+lGi+n+f++++v ++fs+l++++g++++fiE P+l ricp+s+kf++f++ f++n++r+++Y++++vv++ls+i++atsli SwissProt::O74375 30 LGILSIFLCIILGIVNLFHVTLV-VLFSALTIIEGVLLIFIELPFLSRICPVSDKFQAFTNAFASNYYRGLVYFIFSVVTFLSCIFMATSLI 120 69******************988.******************************************************************** PP Cg6151-P 93 vaavlllitavlYglaalkkq 113 ++ ++l++t+++Y++a++k+q SwissProt::O74375 121 ATGIVLALTGLCYTFAGIKGQ 141 *******************98 PP
Or compare SwissProt::O74375 to CDD or PaperBLAST