PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O74375 to PF10233 (Cg6151-P)

SwissProt::O74375 has 164 amino acids

Query:       Cg6151-P  [M=113]
Accession:   PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.4e-40  123.6  15.5      3e-40  123.3  15.5    1.1  1  SwissProt::O74375  


Domain annotation for each sequence (and alignments):
>> SwissProt::O74375  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  123.3  15.5     3e-40     3e-40       1     113 []      30     141 ..      30     141 .. 0.99

  Alignments for each domain:
  == domain 1  score: 123.3 bits;  conditional E-value: 3e-40
           Cg6151-P   1 lGilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatsli 92 
                        lGilsi+lci+lGi+n+f++++v ++fs+l++++g++++fiE P+l ricp+s+kf++f++ f++n++r+++Y++++vv++ls+i++atsli
  SwissProt::O74375  30 LGILSIFLCIILGIVNLFHVTLV-VLFSALTIIEGVLLIFIELPFLSRICPVSDKFQAFTNAFASNYYRGLVYFIFSVVTFLSCIFMATSLI 120
                        69******************988.******************************************************************** PP

           Cg6151-P  93 vaavlllitavlYglaalkkq 113
                        ++ ++l++t+++Y++a++k+q
  SwissProt::O74375 121 ATGIVLALTGLCYTFAGIKGQ 141
                        *******************98 PP



Or compare SwissProt::O74375 to CDD or PaperBLAST