PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O94673 to PF10998 (DUF2838)

SwissProt::O94673 has 403 amino acids

Query:       DUF2838  [M=111]
Accession:   PF10998.12
Description: Protein of unknown function (DUF2838)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-47  147.1   6.6    1.1e-47  147.1   6.6    2.2  2  SwissProt::O94673  


Domain annotation for each sequence (and alignments):
>> SwissProt::O94673  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.1   6.6   1.1e-47   1.1e-47       1     111 []     111     221 ..     111     221 .. 1.00
   2 ?   -1.1   0.9      0.12      0.12      52      80 ..     325     350 ..     312     374 .. 0.54

  Alignments for each domain:
  == domain 1  score: 147.1 bits;  conditional E-value: 1.1e-47
            DUF2838   1 dklsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplal 92 
                        dklsF+lgv +++ltall+g+ape ++l+yt++l+v+lplry+ty++k+++Yf++D+CY+ n+lll++++++pes++lf++ +++++G+la+
  SwissProt::O94673 111 DKLSFALGVSTCILTALLVGMAPESMHLWYTIQLFVYLPLRYYTYQRKGYEYFIADFCYWGNILLLVYIWIFPESRRLFILSYSISYGTLAW 202
                        8******************************************************************************************* PP

            DUF2838  93 AiitwrnslvfhsldkvtS 111
                        ++++wrnsl+fhs+dk+tS
  SwissProt::O94673 203 SVVAWRNSLLFHSIDKITS 221
                        ******************8 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.12
            DUF2838  52 YfllDlCYfvnllllllllvlpeskelfk 80 
                        ++++ + Y ++++l + l++ +   +l+ 
  SwissProt::O94673 325 FMIIQYLYSITTMLPCSLWYNN---KLYS 350
                        4444444444444444444422...2222 PP



Or compare SwissProt::O94673 to CDD or PaperBLAST