SwissProt::P0DSE1 has 268 amino acids
Query: DUF1968 [M=81]
Accession: PF09291.14
Description: Domain of unknown function (DUF1968)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-42 128.4 4.1 7.1e-42 127.7 4.1 1.4 1 SwissProt::P0DSE1
Domain annotation for each sequence (and alignments):
>> SwissProt::P0DSE1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 127.7 4.1 7.1e-42 7.1e-42 1 74 [. 134 207 .. 134 218 .. 0.93
Alignments for each domain:
== domain 1 score: 127.7 bits; conditional E-value: 7.1e-42
DUF1968 1 PavYqLkspkssdtsvCLfTDFdsqvnvsqskeseviktdktvldmksldsKSngavaWsnksdfkCqdtfkee 74
PavYqL+++kssd+svCLfTDFdsq+nvsqsk+s+v++tdktvldm+s+d+KSn+avaWsnksdf+C+++f+++
SwissProt::P0DSE1 134 PAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS 207
9***********************************************************************93 PP
Or compare SwissProt::P0DSE1 to CDD or PaperBLAST