SwissProt::P11519 has 70 amino acids
Query: DUF5431 [M=70]
Accession: PF17496.6
Description: Family of unknown function (DUF5431)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-41 127.0 1.5 1.4e-41 126.9 1.5 1.0 1 SwissProt::P11519
Domain annotation for each sequence (and alignments):
>> SwissProt::P11519
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.9 1.5 1.4e-41 1.4e-41 1 70 [] 1 70 [] 1 70 [] 0.99
Alignments for each domain:
== domain 1 score: 126.9 bits; conditional E-value: 1.4e-41
DUF5431 1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70
m +qhqdsLL r+aqGeegHEt+++ +Lvc++rv+h+v+iH+sD+kiavRd+++rR+qGG+g++GLRir
SwissProt::P11519 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70
99*******************************************************************8 PP
Or compare SwissProt::P11519 to CDD or PaperBLAST