PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P11519 to PF17496 (DUF5431)

SwissProt::P11519 has 70 amino acids

Query:       DUF5431  [M=70]
Accession:   PF17496.7
Description: Family of unknown function (DUF5431)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.2e-41  127.0   1.5    1.4e-41  126.9   1.5    1.0  1  SwissProt::P11519  


Domain annotation for each sequence (and alignments):
>> SwissProt::P11519  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  126.9   1.5   1.4e-41   1.4e-41       1      70 []       1      70 []       1      70 [] 0.99

  Alignments for each domain:
  == domain 1  score: 126.9 bits;  conditional E-value: 1.4e-41
            DUF5431  1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70
                       m +qhqdsLL r+aqGeegHEt+++  +Lvc++rv+h+v+iH+sD+kiavRd+++rR+qGG+g++GLRir
  SwissProt::P11519  1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70
                       99*******************************************************************8 PP



Or compare SwissProt::P11519 to CDD or PaperBLAST