SwissProt::P42517 has 181 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-22 66.5 0.2 2e-18 52.9 0.0 2.2 2 SwissProt::P42517
Domain annotation for each sequence (and alignments):
>> SwissProt::P42517
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.9 0.0 2e-18 2e-18 13 79 .] 33 99 .. 30 99 .. 0.97
2 ! 11.7 0.1 1.5e-05 1.5e-05 1 19 [. 122 140 .. 122 144 .. 0.94
Alignments for each domain:
== domain 1 score: 52.9 bits; conditional E-value: 2e-18
CM_2 13 eLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
l+eRm+++k++a yK+ ++lp+ d Re+ vl+++ ++a+++gl+p+ ve + ++++++s+ +Q+
SwissProt::P42517 33 SALNERMQVMKAVAGYKALHHLPIEDLPREQVVLDHMLQNAQQAGLEPHSVEPFVHALMNASKTIQY 99
689*************************************************************996 PP
== domain 2 score: 11.7 bits; conditional E-value: 1.5e-05
CM_2 1 RkeIdeiDrelleLlaeRm 19
R++I+++D +ll +++R+
SwissProt::P42517 122 RQQIQQLDTQLLTAISQRL 140
9*****************7 PP
Or compare SwissProt::P42517 to CDD or PaperBLAST