SwissProt::P57472 has 385 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-24 69.9 6.7 1.7e-23 69.1 6.2 1.8 2 SwissProt::P57472
Domain annotation for each sequence (and alignments):
>> SwissProt::P57472
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.1 6.2 1.7e-23 1.7e-23 1 79 [] 11 89 .. 11 89 .. 0.99
2 ? -3.4 0.0 0.76 0.76 46 62 .. 311 329 .. 296 341 .. 0.52
Alignments for each domain:
== domain 1 score: 69.1 bits; conditional E-value: 1.7e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+eI++iD+++++LlaeR +l+ +ia+ K en+++++d eRe+++l++l ++++l+ e+++++f+ ii+es+a Qk
SwissProt::P57472 11 RDEINNIDKKIVKLLAERKNLVFKIAQSKIENNQAIRDIEREKKMLQKLIFLGKKYNLKSEYITQLFQLIIEESVATQK 89
99*************************************************999**********************996 PP
== domain 2 score: -3.4 bits; conditional E-value: 0.76
CM_2 46 lerlre..gaeelgldpea 62
l+++ + ++++l +++ +
SwissProt::P57472 311 LSKVLSilQEKKLIMKKLT 329
5555554333333333333 PP
Or compare SwissProt::P57472 to CDD or PaperBLAST