SwissProt::P69532 has 112 amino acids
Query: DUF5455 [M=102]
Accession: PF17537.6
Description: Family of unknown function (DUF5455)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-39 120.8 6.0 1.9e-39 120.6 6.0 1.0 1 SwissProt::P69532
Domain annotation for each sequence (and alignments):
>> SwissProt::P69532
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.6 6.0 1.9e-39 1.9e-39 1 102 [] 8 106 .. 8 106 .. 0.98
Alignments for each domain:
== domain 1 score: 120.6 bits; conditional E-value: 1.9e-39
DUF5455 1 plLlkllkslfvglvgylltfikkkyalaivalglllalivgllvvllnalsavesiaetipsallnglglvlpsnaipcLtvlltarvtvt 92
plLl++l++l+v+l+gylltf+kk+++++++a++l+lali+gl+++l+++ls+++++ +ps++++g++l+lpsna+pc++v+l+++++++
SwissProt::P69532 8 PLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLALIIGLNSILVGYLSDISAQ---LPSDFVQGVQLILPSNALPCFYVILSVKAAIF 96
9*****************************************************888...9******************************* PP
DUF5455 93 lykvkvkllk 102
+++vk+k+++
SwissProt::P69532 97 IFDVKQKIVS 106
********85 PP
Or compare SwissProt::P69532 to CDD or PaperBLAST