PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P79677 to PF10948 (DUF2635)

SwissProt::P79677 has 67 amino acids

Query:       DUF2635  [M=46]
Accession:   PF10948.13
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    8.8e-27   78.9   0.0    1.1e-26   78.7   0.0    1.1  1  SwissProt::P79677  


Domain annotation for each sequence (and alignments):
>> SwissProt::P79677  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.7   0.0   1.1e-26   1.1e-26       1      44 [.       4      47 ..       4      49 .. 0.97

  Alignments for each domain:
  == domain 1  score: 78.7 bits;  conditional E-value: 1.1e-26
            DUF2635  1 vkPkeGltVRdPetgelLpaeGeevprnsfWlRRlkdGDvvevk 44
                       +kP++G+++RdP t++lL++eGee+prnsfW+RRl++GDvvev 
  SwissProt::P79677  4 IKPAAGKAIRDPLTMKLLASEGEEKPRNSFWIRRLAAGDVVEVG 47
                       9*****************************************97 PP



Or compare SwissProt::P79677 to CDD or PaperBLAST