SwissProt::P79677 has 67 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.13
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.8e-27 78.9 0.0 1.1e-26 78.7 0.0 1.1 1 SwissProt::P79677
Domain annotation for each sequence (and alignments):
>> SwissProt::P79677
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.7 0.0 1.1e-26 1.1e-26 1 44 [. 4 47 .. 4 49 .. 0.97
Alignments for each domain:
== domain 1 score: 78.7 bits; conditional E-value: 1.1e-26
DUF2635 1 vkPkeGltVRdPetgelLpaeGeevprnsfWlRRlkdGDvvevk 44
+kP++G+++RdP t++lL++eGee+prnsfW+RRl++GDvvev
SwissProt::P79677 4 IKPAAGKAIRDPLTMKLLASEGEEKPRNSFWIRRLAAGDVVEVG 47
9*****************************************97 PP
Or compare SwissProt::P79677 to CDD or PaperBLAST