SwissProt::P84699 has 93 amino acids
Query: DUF5789 [M=74]
Accession: PF19102.4
Description: Family of unknown function (DUF5789)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-40 122.9 0.5 2.4e-40 122.7 0.5 1.1 1 SwissProt::P84699
Domain annotation for each sequence (and alignments):
>> SwissProt::P84699
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 122.7 0.5 2.4e-40 2.4e-40 1 74 [] 20 93 .] 20 93 .] 0.99
Alignments for each domain:
== domain 1 score: 122.7 bits; conditional E-value: 2.4e-40
DUF5789 1 veGaPlarvasRLtwpiekseivekeGdttiRtpdGpreladvLeevdetyfetrqeFeeaveevigtgPvete 74
v+GaP+arvasRLtw+ +kse+v+keGdt++RtpdGpr+l++vLe+v ++yfetr+eFe++v++++g+gPv+te
SwissProt::P84699 20 VAGAPIARVASRLTWALQKSEVVRKEGDTVVRTPDGPRDLDAVLEDVSTPYFETRREFERDVRAAMGAGPVPTE 93
89**********************************************************************97 PP
Or compare SwissProt::P84699 to CDD or PaperBLAST