PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P96560 to PF06722 (EryCIII-like_C)

SwissProt::P96560 has 409 amino acids

Query:       EryCIII-like_C  [M=145]
Accession:   PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.8e-19   54.6   1.6    5.8e-19   54.6   1.6    2.0  2  SwissProt::P96560  


Domain annotation for each sequence (and alignments):
>> SwissProt::P96560  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.5   0.1      0.12      0.12      88     116 ..      93     121 ..      79     128 .. 0.61
   2 !   54.6   1.6   5.8e-19   5.8e-19      36     125 ..     292     380 ..     285     392 .. 0.86

  Alignments for each domain:
  == domain 1  score: -1.5 bits;  conditional E-value: 0.12
     EryCIII-like_C  88 elGagivlskdeltsdsiakavaevvedp 116
                        + G++ v+   el ++   ++vae+++ p
  SwissProt::P96560  93 AEGCAAVVAAGELAAAAAVRSVAEMLGIP 121
                        45555555555555555555566665555 PP

  == domain 2  score: 54.6 bits;  conditional E-value: 5.8e-19
     EryCIII-like_C  36 vdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaakl 125
                        vd v l+vl   +aa +Hhg ag+ + a  +G+Pq+v+p + d++  a+rva+lG g++l+ +  t d + +ava  ++ ++ ra a+ +
  SwissProt::P96560 292 VDEVNLQVLFSRAAAAIHHGSAGTEHLATLAGIPQIVIPRHTDQPYYAERVADLGIGVALEGPVPTFDAMSAAVATALAPET-RARATAV 380
                        88999**********************************************************9999999999998886443.3333333 PP



Or compare SwissProt::P96560 to CDD or PaperBLAST