SwissProt::P96560 has 409 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-19 54.6 1.6 5.8e-19 54.6 1.6 2.0 2 SwissProt::P96560 Domain annotation for each sequence (and alignments): >> SwissProt::P96560 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.12 0.12 88 116 .. 93 121 .. 79 128 .. 0.61 2 ! 54.6 1.6 5.8e-19 5.8e-19 36 125 .. 292 380 .. 285 392 .. 0.86 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.12 EryCIII-like_C 88 elGagivlskdeltsdsiakavaevvedp 116 + G++ v+ el ++ ++vae+++ p SwissProt::P96560 93 AEGCAAVVAAGELAAAAAVRSVAEMLGIP 121 45555555555555555555566665555 PP == domain 2 score: 54.6 bits; conditional E-value: 5.8e-19 EryCIII-like_C 36 vdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaakl 125 vd v l+vl +aa +Hhg ag+ + a +G+Pq+v+p + d++ a+rva+lG g++l+ + t d + +ava ++ ++ ra a+ + SwissProt::P96560 292 VDEVNLQVLFSRAAAAIHHGSAGTEHLATLAGIPQIVIPRHTDQPYYAERVADLGIGVALEGPVPTFDAMSAAVATALAPET-RARATAV 380 88999**********************************************************9999999999998886443.3333333 PP
Or compare SwissProt::P96560 to CDD or PaperBLAST