SwissProt::P9WEL7 has 453 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-21 62.2 0.0 4.9e-21 61.4 0.0 1.4 1 SwissProt::P9WEL7 Domain annotation for each sequence (and alignments): >> SwissProt::P9WEL7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 0.0 4.9e-21 4.9e-21 5 131 .. 310 435 .. 306 449 .. 0.89 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 4.9e-21 HHHHTSSSEEEE---TTTTSS-SS--SSEEE--S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE-- CS EryCIII-like_C 5 delgevDaeivvtldararedlaslPdnvRlvdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialp 96 ++l + D +++tl + + ++ +lP nv+l++f+P+ lL+ ++ +v GG G+ + al+ GvP + + D+ r a +Ga i l+ SwissProt::P9WEL7 310 EALKDEDVAVIATLVRGPKIEV-DLPSNVKLAEFIPFDILLRHTDVLVSNGGFGTVQMALSLGVPMVLAGVYLDKYYTNSRAASMGAAINLG 400 6667778888888776665555.7******************************************************************** PP TTT--HHHHHHHHHHHHH-HHHHHHHHHHHHHHHT CS EryCIII-like_C 97 kdeldadslaeavarvledpayreaaaklaeeala 131 + ++++ +++av +l d+ +e +++e + SwissProt::P9WEL7 401 CERVEPSVVKTAVCDILSDQKRKERCLQIKEKYAE 435 **************************999988765 PP
Or compare SwissProt::P9WEL7 to CDD or PaperBLAST