SwissProt::Q54IL5 has 1697 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-12 32.9 0.0 5.5e-12 32.0 0.0 1.4 1 SwissProt::Q54IL5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q54IL5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.0 0.0 5.5e-12 5.5e-12 46 126 .. 1509 1589 .. 1501 1595 .. 0.94
Alignments for each domain:
== domain 1 score: 32.0 bits; conditional E-value: 5.5e-12
EryCIII-like_C 46 ptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraaaakla 126
+ + ++ hgGag+++++l + P +v+p + d++ ++r++++G g +++ d lt++s+ + + ++++p+ ra +k+
SwissProt::Q54IL5 1509 EKVSLVISHGGAGTVAASLLAAKPTIVVPFFGDQFFWGERIKQTGIGTSIPFDILTAKSLSSHIISILNEPSVRAKVNKMS 1589
5667799********************************************************************999886 PP
Or compare SwissProt::Q54IL5 to CDD or PaperBLAST