SwissProt::Q57696 has 99 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.2e-26 76.4 4.4 1.1e-25 76.1 4.4 1.1 1 SwissProt::Q57696
Domain annotation for each sequence (and alignments):
>> SwissProt::Q57696
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.1 4.4 1.1e-25 1.1e-25 1 79 [] 9 87 .. 9 87 .. 0.99
Alignments for each domain:
== domain 1 score: 76.1 bits; conditional E-value: 1.1e-25
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
Rk+IdeiD+++l+L+aeR +lak++ae+K + g+p+ dpeRe+ + +r+r+ +e+++d+++ kif+ +i++ +alQk
SwissProt::Q57696 9 RKKIDEIDNKILKLIAERNSLAKDVAEIKNQLGIPINDPEREKYIYDRIRKLCKEHNVDENIGIKIFQILIEHNKALQK 87
9****************************************************************************96 PP
Or compare SwissProt::Q57696 to CDD or PaperBLAST